Protein Info for GFF1631 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 25 to 52 (28 residues), see Phobius details PF13428: TPR_14" amino acids 90 to 130 (41 residues), 23.7 bits, see alignment 7.7e-09 PF13181: TPR_8" amino acids 92 to 116 (25 residues), 18.1 bits, see alignment (E = 3.4e-07) PF14559: TPR_19" amino acids 97 to 157 (61 residues), 28.1 bits, see alignment E=3.2e-10

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>GFF1631 hypothetical protein (Sphingobium sp. HT1-2)
MIFLVASICIQIICAVDVVRSGRNQIWMLFIFLFSLAGCFAYLMLEVLPAYWGNRHLRTA
RRQVVGKVDPERGLRKARADLDLAETAANRIALGDALLDLGRFAEAEAAYRKGLALGPGQ
DATTQVKLAQTLFELGRSREGLAELDDVPEVGRGSEWDRRALLRARMLADIGEDAQARLL
FEDVMSRYAGEEARCHYAAFLLEQGDRLRARQILEEVEQRASRLDRTQRAAQADMYRWAG
ERLAELRKAAA