Protein Info for GFF1628 in Sphingobium sp. HT1-2

Annotation: Acetyl-coenzyme A carboxyl transferase beta chain (EC 6.4.1.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 TIGR00515: acetyl-CoA carboxylase, carboxyl transferase, beta subunit" amino acids 1 to 279 (279 residues), 357.3 bits, see alignment E=3e-111 PF17848: Zn_ribbon_ACC" amino acids 24 to 49 (26 residues), 31.7 bits, see alignment (E = 1.5e-11) PF01039: Carboxyl_trans" amino acids 97 to 238 (142 residues), 45.2 bits, see alignment E=5.4e-16

Best Hits

Swiss-Prot: 73% identical to ACCD_NOVAD: Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD) from Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)

KEGG orthology group: K01963, acetyl-CoA carboxylase carboxyl transferase subunit beta [EC: 6.4.1.2] (inferred from 94% identity to sch:Sphch_0665)

Predicted SEED Role

"Acetyl-coenzyme A carboxyl transferase beta chain (EC 6.4.1.2)" in subsystem Fatty Acid Biosynthesis FASII (EC 6.4.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.2

Use Curated BLAST to search for 6.4.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (282 amino acids)

>GFF1628 Acetyl-coenzyme A carboxyl transferase beta chain (EC 6.4.1.2) (Sphingobium sp. HT1-2)
MSWINRVRNALPFTKKETTAETLWHQCPSCKEMVFIKEWEENLSVCPRCDHHGRIGPSER
FEQILDAGFILLPTPGVPEDPLKFRDSKRYPDRIKAARASTGDQDALINARGAIDDVPLV
MGVQNFAFMGGSMGMGVGAAFIQGINDAIAHKCPYVIFTAAGGARMQEGILSLMQMPRST
VAIQKLHAAGLPYIVVLTDPTTGGVTASYAMLGDIQISEPNALIGFAGQRVIESTIREKL
PEGFQRAEYLLDHGMLDMVVHRSELRDTLARVIGYLTPRAAA