Protein Info for GFF1623 in Variovorax sp. SCN45

Annotation: Glycerol-3-phosphate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 26 to 48 (23 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 153 to 178 (26 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details amino acids 253 to 274 (22 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details amino acids 326 to 344 (19 residues), see Phobius details amino acids 350 to 372 (23 residues), see Phobius details amino acids 384 to 403 (20 residues), see Phobius details amino acids 415 to 434 (20 residues), see Phobius details PF07690: MFS_1" amino acids 33 to 399 (367 residues), 173.9 bits, see alignment E=2.3e-55

Best Hits

KEGG orthology group: K02445, MFS transporter, OPA family, glycerol-3-phosphate transporter (inferred from 84% identity to cti:RALTA_B0681)

Predicted SEED Role

"Glycerol-3-phosphate transporter" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (436 amino acids)

>GFF1623 Glycerol-3-phosphate transporter (Variovorax sp. SCN45)
MQLANQGLQAGAYAPPLEHSFRRAQWRMLLAAMFCYFFFYTGRQTFGFAIPGLQKEFGLS
KEVLGWASASLLWCYAIGQAINGNLADKFGGRRVMTAGAILSCAANWVVSFAIGFKSLAI
PWGINGYFQALGWAPGSRLLSNWWGAGERGKVFGFYTFAAGCASILSFVTSIVVVNVLHL
DWRWIFRLPVLLMLVGGIVFYLVARERPEDLGFKSPDTGIANAEDAKAAAARQHAPDESS
WTRYKAVLSNPKLLIAALAIGFQNAARYGLIVWVPVHFLGKDWSKVSDGMIDPAWISVAL
PVGMAFGALTNGWISDRVFGSKRYKAIVLYMLLGAVASVGMYVLPTSIGGLALLFLAGFF
VYGPASSFWALCPDLVGAKRSGTATGVMNFFSYLLAGLGEPLIGRMLDHSGNTSMVFPIV
ATSCLISAFIALFIRR