Protein Info for PS417_08245 in Pseudomonas simiae WCS417

Annotation: CDP-6-deoxy-L-threo-D-glycero-4-hexulose-3- dehydrase reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 PF00111: Fer2" amino acids 10 to 75 (66 residues), 40.2 bits, see alignment E=4.1e-14 PF00970: FAD_binding_6" amino acids 102 to 194 (93 residues), 59.9 bits, see alignment E=4e-20 PF00175: NAD_binding_1" amino acids 206 to 307 (102 residues), 65.9 bits, see alignment E=7.3e-22

Best Hits

KEGG orthology group: K00523, CDP-4-dehydro-6-deoxyglucose reductase [EC: 1.17.1.1] (inferred from 66% identity to pfl:PFL_5093)

Predicted SEED Role

"CDP-6-deoxy-delta-3,4-glucoseen reductase-like"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.1

Use Curated BLAST to search for 1.17.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UI92 at UniProt or InterPro

Protein Sequence (329 amino acids)

>PS417_08245 CDP-6-deoxy-L-threo-D-glycero-4-hexulose-3- dehydrase reductase (Pseudomonas simiae WCS417)
MSIVTLSNHKSFTGESGKSLLECAKSQGTVLEYSCRTGRCGVCKANVLQGDTEVMQPELA
LTDEERANGAILTCCRAALTDVELDIEDLGLLADIQIKTMPCRLDTLERLADDVVRVVLR
TPPKSALFYLPGQYIDVIGKDGVRRSYSIANAVREDAKLELHIRQVPDGVMSQYWFGEAQ
VNDLLRLEGPLGTFCLRNASTTNLVFMATGTGIAPVKAMLEALASTSEPLIGKRVYVYWG
GRTENDLYWLPDFPTLGMTYRPVLSRAGKHWPGATGYVQQAVLAENLDLADTSVYACGSE
AMIHTAREMLTQAGLPLKHFHSDAFVSSN