Protein Info for GFF162 in Xanthobacter sp. DMC5

Annotation: Tetraacyldisaccharide 4'-kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 signal peptide" amino acids 13 to 13 (1 residues), see Phobius details transmembrane" amino acids 14 to 32 (19 residues), see Phobius details PF02606: LpxK" amino acids 17 to 322 (306 residues), 287.9 bits, see alignment E=5e-90 TIGR00682: tetraacyldisaccharide 4'-kinase" amino acids 19 to 314 (296 residues), 182 bits, see alignment E=7.6e-58

Best Hits

Swiss-Prot: 68% identical to LPXK_XANP2: Tetraacyldisaccharide 4'-kinase (lpxK) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K00912, tetraacyldisaccharide 4'-kinase [EC: 2.7.1.130] (inferred from 68% identity to xau:Xaut_1481)

MetaCyc: 44% identical to tetraacyldisaccharide 4'-kinase (Brucella abortus 2308)
Tetraacyldisaccharide 4'-kinase. [EC: 2.7.1.130]

Predicted SEED Role

"Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130)" in subsystem KDO2-Lipid A biosynthesis or Lipopolysaccharide-related cluster in Alphaproteobacteria (EC 2.7.1.130)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.130

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>GFF162 Tetraacyldisaccharide 4'-kinase (Xanthobacter sp. DMC5)
MLRAPAFWWRDQPGLAAALLSPVAAIIGGVALRRLGKAGGMVDVPVICIGNPTVGGAGKT
PTAIALIERLKARGAQPFALLRGHGGKAKAPLRVDPAHHTASEVGDEALLLARHAPTVVA
GGDRLGGARLAVKAGATHVVMDDGFQNPSLHKDCTLLVIDGGVGVGNGCVTPSGPLRAPL
APQLAKADAVLVIGDGAPGAAVAGAARAADLPVLSGHLAPEASAIAALRGRPLVAFAGIG
RPEKFFATLEAEGLNLVGRHAFPDHHPYRPEEMAHLAGEARRLGARLVTTQKDFVRLGPE
FTVTAQIAQLPVSLVLGGGDRLDTLIGWAEARVAARRL