Protein Info for PS417_08215 in Pseudomonas simiae WCS417

Annotation: flippase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 43 to 69 (27 residues), see Phobius details amino acids 101 to 124 (24 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 169 to 186 (18 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details amino acids 238 to 261 (24 residues), see Phobius details amino acids 272 to 295 (24 residues), see Phobius details amino acids 316 to 337 (22 residues), see Phobius details amino acids 351 to 373 (23 residues), see Phobius details amino acids 382 to 402 (21 residues), see Phobius details amino acids 408 to 428 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 60% identity to pfl:PFL_5099)

Predicted SEED Role

"Putative O-unit flippase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UF06 at UniProt or InterPro

Protein Sequence (436 amino acids)

>PS417_08215 flippase (Pseudomonas simiae WCS417)
MNYKKIFDHDFRNTAINQLWRLLSGPALLILVPLYLSSEAQGYWYTFISMAALAVFADMG
FSAVLLLFASHEFAHLKFNNQKELCGTPEHISRLATLLSFAMRWAGAMALVVFPAVLLIG
YFILNGKTSLVNWQLPWLVYGVASVIVFINSIALSFIEGCDSVGDIQKIRFHISVISVCV
TVILLISGADLYALAFSLLAGALAGTSIILHRYKAMLGQLYKLTKVNSHPWFKEIMPLLW
RFALSWISGYFVLSIFTPLSFSYHGAVQAGQVGFSMAICMAMFSIANIWVTIITPKINMY
AAHRNTTALDQAFKKGLALAIATYAMGMVTLFTGLWLMEGQPLIENRLLPSLPLLMVSTG
WLMQLIVNAMAIYMRAYKKEPLVVVSVVNGLYVAITTLLAAKYLPFEYLFSGFTSAYVLV
LPWVYWIFRSFKRRSS