Protein Info for PS417_08205 in Pseudomonas simiae WCS417

Annotation: acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details PF14602: Hexapep_2" amino acids 150 to 185 (36 residues), 28.6 bits, see alignment 9.3e-11 PF00132: Hexapep" amino acids 151 to 185 (35 residues), 43.2 bits, see alignment 2e-15

Best Hits

KEGG orthology group: K08280, lipopolysaccharide O-acetyltransferase [EC: 2.3.1.-] (inferred from 53% identity to pfl:PFL_5101)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U943 at UniProt or InterPro

Protein Sequence (214 amino acids)

>PS417_08205 acetyltransferase (Pseudomonas simiae WCS417)
MSYFLKKLKQHHVFIVPMVFGQCLLVWRAFIHLRAFPAPGRRAYLGRAPKVFGLEHITLG
NNFRVGEGLWLHAISQYLTFKYQPQVDIGENFSASDHLHIACCNKITIGRNVLMGSKIHI
TDHSHGAYSGENQSSPYETPFERKLASSGPVTIGDNVWIGDNVVVLPNTSIGNGSIIGAN
SIVTKDIPSHVIAVGCPARVVKVWSDKESKWLNV