Protein Info for GFF1603 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 51 to 81 (31 residues), see Phobius details amino acids 93 to 115 (23 residues), see Phobius details amino acids 121 to 143 (23 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 218 to 243 (26 residues), see Phobius details amino acids 256 to 278 (23 residues), see Phobius details amino acids 287 to 307 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 43 to 302 (260 residues), 124.7 bits, see alignment E=2e-40

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 54% identity to xau:Xaut_1439)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (322 amino acids)

>GFF1603 hypothetical protein (Xanthobacter sp. DMC5)
MTTVTTQPLRTRKTVGGINLELVGIALVAIFFLVMPFFVYPVFLMKAMSYAILGIAVNLL
LGYVGLLSFGHAAFFGMSAYIFGYFAKTSGLGIGPSLVIAVTCGTVLGAAFAAIAIRRTE
FYFAMTTLALAQLVYFICVQAPFTGGDDGLQGIPRGTIFGFSLQNNANIYIFVFTLFMFC
VLLTYRIINSPFGEILKAIRENSSRVASLGYNPQTYKFVAFVLSAFLASVGGALKALVFQ
IAALPDVHWLMSGDGVLMALVGGIGTLVGPVVGALFIVTAQDGLAELGVSIVVLQGVLFM
AAVLLFRRGIVGELVRFRKWLP