Protein Info for PS417_08145 in Pseudomonas simiae WCS417

Annotation: 30S ribosomal protein S1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 561 TIGR00717: ribosomal protein bS1" amino acids 3 to 522 (520 residues), 707.5 bits, see alignment E=4.6e-217 PF00575: S1" amino acids 105 to 173 (69 residues), 45.7 bits, see alignment E=1.8e-15 amino acids 191 to 262 (72 residues), 78.4 bits, see alignment E=1.1e-25 amino acids 280 to 349 (70 residues), 69.5 bits, see alignment E=6.6e-23 amino acids 363 to 436 (74 residues), 67.5 bits, see alignment E=2.8e-22 amino acids 452 to 522 (71 residues), 52.8 bits, see alignment E=1.1e-17 PF23459: S1_RRP5" amino acids 452 to 520 (69 residues), 33.1 bits, see alignment E=1.7e-11

Best Hits

Swiss-Prot: 88% identical to RS1_PSEAE: 30S ribosomal protein S1 (rpsA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02945, small subunit ribosomal protein S1 (inferred from 97% identity to pfo:Pfl01_4072)

MetaCyc: 74% identical to 30S ribosomal subunit protein S1 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S1p" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UI65 at UniProt or InterPro

Protein Sequence (561 amino acids)

>PS417_08145 30S ribosomal protein S1 (Pseudomonas simiae WCS417)
MSESFAELFEESLKTLNLQAGSIITGVIVDIDYQARWVTVHAGLKSEALIPLEQFYNDAG
DLTINVGDEVHVALDSVEDGFGETKLSREKAKRAECWIVLEAAFAAEEVVKGVINGKVKG
GFTVDVNGIRAFLPGSLVDVRPVRDTTHLEGKELEFKVIKLDQKRNNVVVSRRSVLEAEN
SAEREALLESLQEGQQVKGIVKNLTDYGAFVDLGGVDGLLHITDMAWKRIKHPSEIVNVG
DEIDVKVLKYDRERNRVSLGLKQLGEDPWVAIKARYPESTRVTARVTNLTDYGCFAELEE
GVEGLVHVSEMDWTNKNIHPSKVVQVGDEVEVMVLDIDEERRRISLGIKQCKSNPWEDFS
GQFNKGDKISGTIKSITDFGIFIGLDGGIDGLVHLSDISWNEVGEEAVRRFKKGDELDTV
ILSVDPERERISLGIKQLESDPFSEYVQENDKGAIVKGTVKEVDAKGAIIVLADDIEATL
KASEISRDRVEDARNVLKEGQEVEAKIISVDRKSRVIQLSIKSKDEVEEKEAIQSLKSAP
EAAPGETTMASLLREAMAKQN