Protein Info for GFF1600 in Xanthobacter sp. DMC5

Annotation: 2-(hydroxymethyl)glutarate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03807: F420_oxidored
  • amino acids 10 to 72 (63 residues), 23.1 bits, E=1.4e-08
• PF03446: NAD_binding_2
  • amino acids 10 to 164 (155 residues), 136.7 bits, E=1.2e-43
• PF14833: NAD_binding_11
  • amino acids 170 to 290 (121 residues), 128.3 bits, E=2.9e-41

Best Hits

Swiss-Prot: 39% identical to HMGD_EUBBA: 2-(hydroxymethyl)glutarate dehydrogenase (Hgd) from Eubacterium barkeri

KEGG orthology group: None (inferred from 52% identity to rec:RHECIAT_PB0000108)

MetaCyc: 39% identical to 2-(hydroxymethyl)glutarate dehydrogenase subunit (Eubacterium barkeri)
2-hydroxymethylglutarate dehydrogenase. [EC: 1.1.1.291]

Predicted SEED Role

No annotation

MetaCyc Pathways

• nicotinate degradation III (4/9 steps found)
• superpathway of nicotinate degradation (6/18 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.291

Protein Sequence (298 amino acids)

>GFF1600 2-(hydroxymethyl)glutarate dehydrogenase (Xanthobacter sp. DMC5)
MSEPNGNPAIGFVGLGAMGMPMAKRLVDAGYRVTGFDLAASARSAFEEAGGIAAETVALA
MAHKDVAITMLPNGGVVRQALLQSGGAAAMNSSGIVVDMSSSAPAGTVSLSETLAGIGLT
LIDAPVSGGVKKAREGGLAIMIGGPVEAIERIRPILSCFGSAQFLAGPTGAGHAVKSLNN
YVSAAGLAAMCEALAVGRRFGVAPGALIDILNASSGRNNSTENKAKQFVLSGTYDAGFAM
ALMAKDIGIAADLAAGLGINLPGLTLMRDMWVTASKQLGPAADHTEIDRYITDLSESR