Protein Info for GFF1600 in Xanthobacter sp. DMC5

Annotation: 2-(hydroxymethyl)glutarate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 PF03807: F420_oxidored" amino acids 10 to 72 (63 residues), 23.1 bits, see alignment E=1.4e-08 PF03446: NAD_binding_2" amino acids 10 to 164 (155 residues), 136.7 bits, see alignment E=1.2e-43 PF14833: NAD_binding_11" amino acids 170 to 290 (121 residues), 128.3 bits, see alignment E=2.9e-41

Best Hits

Swiss-Prot: 39% identical to HMGD_EUBBA: 2-(hydroxymethyl)glutarate dehydrogenase (Hgd) from Eubacterium barkeri

KEGG orthology group: None (inferred from 52% identity to rec:RHECIAT_PB0000108)

MetaCyc: 39% identical to 2-(hydroxymethyl)glutarate dehydrogenase subunit (Eubacterium barkeri)
2-hydroxymethylglutarate dehydrogenase. [EC: 1.1.1.291]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.291

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>GFF1600 2-(hydroxymethyl)glutarate dehydrogenase (Xanthobacter sp. DMC5)
MSEPNGNPAIGFVGLGAMGMPMAKRLVDAGYRVTGFDLAASARSAFEEAGGIAAETVALA
MAHKDVAITMLPNGGVVRQALLQSGGAAAMNSSGIVVDMSSSAPAGTVSLSETLAGIGLT
LIDAPVSGGVKKAREGGLAIMIGGPVEAIERIRPILSCFGSAQFLAGPTGAGHAVKSLNN
YVSAAGLAAMCEALAVGRRFGVAPGALIDILNASSGRNNSTENKAKQFVLSGTYDAGFAM
ALMAKDIGIAADLAAGLGINLPGLTLMRDMWVTASKQLGPAADHTEIDRYITDLSESR