Protein Info for PS417_00805 in Pseudomonas simiae WCS417

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 546 signal peptide" amino acids 1 to 41 (41 residues), see Phobius details PF12450: vWF_A" amino acids 84 to 174 (91 residues), 131.4 bits, see alignment E=2.4e-42 PF13768: VWA_3" amino acids 191 to 348 (158 residues), 42 bits, see alignment E=2.6e-14 PF00092: VWA" amino acids 191 to 353 (163 residues), 80.6 bits, see alignment E=4.4e-26 PF13519: VWA_2" amino acids 192 to 296 (105 residues), 57.2 bits, see alignment E=6.2e-19 PF12034: YfbK_C" amino acids 367 to 544 (178 residues), 225.3 bits, see alignment E=1.8e-70

Best Hits

Swiss-Prot: 52% identical to YFBK_ECOLI: Uncharacterized protein YfbK (yfbK) from Escherichia coli (strain K12)

KEGG orthology group: K07114, uncharacterized protein (inferred from 91% identity to pfs:PFLU0165)

Predicted SEED Role

"Von Willebrand factor type A domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U0N3 at UniProt or InterPro

Protein Sequence (546 amino acids)

>PS417_00805 hypothetical protein (Pseudomonas simiae WCS417)
MSRPLLFLRPAAQGFAVTLLVTLAGCGLSSSHDAAEPAEAAPVSELQSVPVQGALVKRMP
MPAPMSAQRVMQDSIAMEYRSEPREQYENLPDNPVHRVAETPVSTFSVDVDTGSYANVRR
FLNQGSLPPEGAVRLEEMVNYFPYSYALPTDGSPFGVTTEVAATPWNPRTQLLRIGIKAS
DRAVAQLAPANLVFLVDVSGSMDRREGLPLVKSTLKLLVDQLREQDRVSLVVYAAESRVV
LKPTSGRDKQKIRNAIDQLTAGGSTAGASGIELAYQMAREGFIDKGINRILLATDGDFNV
GISDFDSLKQMAAEQRKSGVSLTTLGFGVDNYNEHLMEQLADAGDGNYAYIDTLREARKV
LVDQLSSTLAVVARDVKVQVEFNPARVSEYRLLGYENRALKREDFNNDKVDAGEIGAGHT
VTALYEIVPKGEKGWLEPLRYAAVPAPEEKSAELAMLRVRYKPAAEGDSQLIERPISTVS
GKASEDLRFAAAVAAFAQQLKGDGRYTGSMSLQDTAALARSARGNDPFGLRNEFVQLVEL
AQSLKH