Protein Info for GFF1597 in Xanthobacter sp. DMC5

Annotation: Muconate cycloisomerase 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 PF02746: MR_MLE_N" amino acids 24 to 137 (114 residues), 50.3 bits, see alignment E=2.6e-17 PF13378: MR_MLE_C" amino acids 160 to 371 (212 residues), 165.7 bits, see alignment E=1.3e-52

Best Hits

Predicted SEED Role

"O-succinylbenzoate synthase (EC 4.2.1.113)" (EC 4.2.1.113)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.113

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (383 amino acids)

>GFF1597 Muconate cycloisomerase 1 (Xanthobacter sp. DMC5)
MDEAKASLRTMDRERIASIDCFPARLTLRKPIAGSGGTIRSVEVLYVRLRSAGGAEGWGE
AIADPGNTGETLDGMVAMIAARLAPAVTGRGIHERAMVMAKTRSAIHANRAAMTAVEMAW
LDLAGTLCDVPVVELLGGARRDRVPLIAIVGSSGVRSDAIEEAAEQHAAGVRAFKLKVGL
GSLSADLDTLREVRETIGEDSFLAADANMAWDVDTALRFARRAAEIGLDCLEQPVSKDHG
RMRAVGRQSPVRIAADEAIHGANDLLALADTGAIAGASLKSIKLGGVSQAIELAAIADAR
GLSIGFAMMMESGLATAAMVHAACAAAKLDWHLNAGMDFITDDPFGADLERRDGCLLLPK
RQGLGVSVRENAISNLGLRERER