Protein Info for GFF1597 in Xanthobacter sp. DMC5

Annotation: Muconate cycloisomerase 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02746: MR_MLE_N
  • amino acids 24 to 137 (114 residues), 50.3 bits, E=2.6e-17
• PF13378: MR_MLE_C
  • amino acids 160 to 371 (212 residues), 165.7 bits, E=1.3e-52

Predicted SEED Role

"O-succinylbenzoate synthase (EC 4.2.1.113)" (EC 4.2.1.113)

MetaCyc Pathways

• superpathway of chorismate metabolism (41/59 steps found)
• 2-carboxy-1,4-naphthoquinol biosynthesis (3/7 steps found)
• superpathway of menaquinol-10 biosynthesis (5/10 steps found)
• superpathway of menaquinol-8 biosynthesis I (5/10 steps found)
• superpathway of menaquinol-9 biosynthesis (5/10 steps found)
• superpathway of demethylmenaquinol-8 biosynthesis I (4/9 steps found)
• superpathway of demethylmenaquinol-9 biosynthesis (4/9 steps found)
• superpathway of menaquinol-11 biosynthesis (4/10 steps found)
• superpathway of menaquinol-12 biosynthesis (4/10 steps found)
• superpathway of menaquinol-13 biosynthesis (4/10 steps found)
• superpathway of menaquinol-6 biosynthesis (4/10 steps found)
• superpathway of menaquinol-7 biosynthesis (4/10 steps found)
• superpathway of demethylmenaquinol-6 biosynthesis I (3/9 steps found)
• superpathway of phylloquinol biosynthesis (4/15 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.113

Protein Sequence (383 amino acids)

>GFF1597 Muconate cycloisomerase 1 (Xanthobacter sp. DMC5)
MDEAKASLRTMDRERIASIDCFPARLTLRKPIAGSGGTIRSVEVLYVRLRSAGGAEGWGE
AIADPGNTGETLDGMVAMIAARLAPAVTGRGIHERAMVMAKTRSAIHANRAAMTAVEMAW
LDLAGTLCDVPVVELLGGARRDRVPLIAIVGSSGVRSDAIEEAAEQHAAGVRAFKLKVGL
GSLSADLDTLREVRETIGEDSFLAADANMAWDVDTALRFARRAAEIGLDCLEQPVSKDHG
RMRAVGRQSPVRIAADEAIHGANDLLALADTGAIAGASLKSIKLGGVSQAIELAAIADAR
GLSIGFAMMMESGLATAAMVHAACAAAKLDWHLNAGMDFITDDPFGADLERRDGCLLLPK
RQGLGVSVRENAISNLGLRERER