Protein Info for GFF1594 in Sphingobium sp. HT1-2

Annotation: Glucokinase (EC 2.7.1.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 PF02685: Glucokinase" amino acids 5 to 323 (319 residues), 300.7 bits, see alignment E=5.7e-94 TIGR00749: glucokinase" amino acids 6 to 318 (313 residues), 250 bits, see alignment E=1.7e-78

Best Hits

Swiss-Prot: 50% identical to GLK_ZYMMO: Glucokinase (glk) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K00845, glucokinase [EC: 2.7.1.2] (inferred from 82% identity to sjp:SJA_C1-20880)

Predicted SEED Role

"Glucokinase (EC 2.7.1.2)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis (EC 2.7.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>GFF1594 Glucokinase (EC 2.7.1.2) (Sphingobium sp. HT1-2)
MTDIIAADIGGTNARFTRASLDDKGVPTLGTVRKYKVADYPSLQACWGAFVEDESKDSDT
PLPDAASIAFATAIGREVIKLTNSNWVIRADTLAEDLGLRTVRLVNDFEAVAHAVSRLPD
ENLPLLFGEDRPFPRDGGVTVVGPGTGLGVAMIAYDDGHPHVIATEGGHLDFAPLDQIEV
KILDYLRDKFLRVSTERIVSGPGLNYIYKALATIGHDRVMLMEDPELWQAALDGSDEFAH
RALDRFCLCYGSVAGDLALAHGPHAVVLAGGLTQRMKDFLKQSGFHARFKAKGRFESLMA
TVPIRCAIHEEIGLFGAAAAFREKNA