Protein Info for GFF1589 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: L-proline glycine betaine binding ABC transporter protein ProX (TC 3.A.1.12.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF04069: OpuAC" amino acids 30 to 304 (275 residues), 170.1 bits, see alignment E=3.5e-54

Best Hits

Swiss-Prot: 100% identical to PROX_SALTY: Glycine betaine/proline betaine-binding periplasmic protein (proX) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02002, glycine betaine/proline transport system substrate-binding protein (inferred from 99% identity to spq:SPAB_03491)

MetaCyc: 83% identical to glycine betaine ABC transporter periplasmic binding protein ProX (Escherichia coli K-12 substr. MG1655)
RXN-8638 [EC: 7.6.2.9]; 7.4.2.- [EC: 7.6.2.9]

Predicted SEED Role

"L-proline glycine betaine binding ABC transporter protein ProX (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>GFF1589 L-proline glycine betaine binding ABC transporter protein ProX (TC 3.A.1.12.1) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MRHTVIFASAFATLVTASAFAADLPGKGITVQPIQSTISEETFQTLLVSRALEKLGYTVN
KPSEVDYNVGYTSIASGDATFTAVNWQPLHDDMYAAAGGDNKFYREGVFVSGAAQGYLID
KKTAEQYNITNIAQLKDPKIAKIFDTNGDGKADMMGCSPGWGCEAVINHQNKAFDLQKTV
EVSHGNYAAMMADTITRFKEGKPVLYYTWTPYWVSDVMKPGKDVVWLQVPFSSLPGEQKN
IDTKLPNGANYGFPVNTMHIVANKAWAEKNPAAAKLFAIMKLPLADINAQNAMMHAGKSS
EADVQGHVDGWINAHQQQFDGWVKEALAAQK