Protein Info for PS417_08075 in Pseudomonas simiae WCS417

Annotation: methionine ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 PF00005: ABC_tran" amino acids 24 to 183 (160 residues), 99.7 bits, see alignment E=4.3e-32 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 233 to 311 (79 residues), 65.6 bits, see alignment E=1.7e-22 PF08352: oligo_HPY" amino acids 235 to 298 (64 residues), 62.8 bits, see alignment E=6.6e-21

Best Hits

Swiss-Prot: 49% identical to OPPD_SALTY: Oligopeptide transport ATP-binding protein OppD (oppD) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein (inferred from 96% identity to pfs:PFLU1634)

MetaCyc: 48% identical to murein tripeptide ABC transporter / oligopeptide ABC transporter ATP binding subunit OppD (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]; 7.4.2.6 [EC: 7.4.2.6]

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TXC8 at UniProt or InterPro

Protein Sequence (318 amino acids)

>PS417_08075 methionine ABC transporter ATP-binding protein (Pseudomonas simiae WCS417)
MSLLQVRDLSVIANNAGRDVTLVDRVSFDLAEGEILGLVGESGSGKTMACRGLMRLLPSP
NLRVQGGAVRLGGQDLLSLDDAGMRAVRGGQLGMIFQNPSSHLDPLMRIGEQIAEGIRLH
QGASKKDARLQAIEVLRQVGIPDPQARVDNYPQEFSGGMRQRAMIAVALGCNPKVLIADE
PTTALDVTVQAQILRLLLELRDQRGLSIIMITHDLGVVAQTCDAIAVMYAGCLCEHGSKY
DVLAQPQHPYTAGLIDCQPAHSSGHALLRTIPGQPPLLDALPAGCRFNPRCPQVGALCTE
VLPEGQRVACHYPLGAQP