Protein Info for GFF1584 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Ribonucleotide reduction protein NrdI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00333: nrdI protein
  • amino acids 5 to 130 (126 residues), 193.6 bits, E=5.6e-62
• PF07972: Flavodoxin_NdrI
  • amino acids 5 to 122 (118 residues), 159.5 bits, E=2e-51

Best Hits

Swiss-Prot: 100% identical to NRDI_SALCH: Protein NrdI (nrdI) from Salmonella choleraesuis (strain SC-B67)

KEGG orthology group: K03647, protein involved in ribonucleotide reduction (inferred from 96% identity to ses:SARI_00167)

Predicted SEED Role

"Ribonucleotide reduction protein NrdI" in subsystem Ribonucleotide reduction

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (26/26 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (14/14 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (8/8 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (7/7 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• adenosine deoxyribonucleotides de novo biosynthesis II (4/4 steps found)
• guanosine deoxyribonucleotides de novo biosynthesis II (4/4 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• adenosine deoxyribonucleotides de novo biosynthesis I (2/2 steps found)
• guanosine deoxyribonucleotides de novo biosynthesis I (2/2 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)

Protein Sequence (136 amino acids)

>GFF1584 Ribonucleotide reduction protein NrdI (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSALVYFSSSSENTHRFMQRLGLPATRIPLNERERIQVDEPYILVVPSYGGGGMAGAVPR
QVIRFLNDEHNRARIRGVIASGNRNFGDAWGCAGDVIAQKCGVPWLYRFELMGTQRDIDN
VRKGVNEFWQQLPRSA