Protein Info for GFF1582 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 46 to 67 (22 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 127 to 145 (19 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 233 to 252 (20 residues), see Phobius details amino acids 271 to 295 (25 residues), see Phobius details amino acids 307 to 326 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 50 to 322 (273 residues), 157.4 bits, see alignment E=2e-50

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 98% identity to xau:Xaut_1708)

Predicted SEED Role

"Branched-chain amino acid transport ATP-binding protein LivG (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (348 amino acids)

>GFF1582 hypothetical protein (Xanthobacter sp. DMC5)
MSVTPHPHPVPLTRTTSPMGFSRGGIALAVLSGAAALLPLVTADSFLIHSAIMVLFFAYM
ATSWNFLCGYVGQLSLGHAMFSGVGGYVSVLLFTTYGLSPWIGMLVGGLVAAALSVFIGY
PTFRLKGPYFALTTIAFAEIVRIWVENTDSFLGFRIKGAEGLVVPGVGGDSFWAFQFSGK
VPYYYIILAMLVLAILATMVMERSKLGYCLKAIRGDRDAAEALGISPTRYTQAAFAISAF
MTALGGSFYAQFFRYINPERNMGLELSIDMALMSIIGGQGTPFGPLVGALLLMPLGEISR
GYLGGQFLGLHLVIYGIVLMITVLYFPKGLIAPITALANRLFGRGGRP