Protein Info for PS417_08025 in Pseudomonas simiae WCS417

Annotation: acetylornithine aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 TIGR00707: transaminase, acetylornithine/succinylornithine family" amino acids 6 to 388 (383 residues), 453 bits, see alignment E=3.7e-140 PF00202: Aminotran_3" amino acids 10 to 387 (378 residues), 378.9 bits, see alignment E=1.3e-117

Best Hits

Swiss-Prot: 75% identical to ARGD2_PSESM: Acetylornithine aminotransferase 2 (argD2) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K00818, acetylornithine aminotransferase [EC: 2.6.1.11] (inferred from 94% identity to pfs:PFLU1624)

Predicted SEED Role

"Acetylornithine aminotransferase (EC 2.6.1.11)" in subsystem Arginine Biosynthesis extended (EC 2.6.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.11

Use Curated BLAST to search for 2.6.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TXC2 at UniProt or InterPro

Protein Sequence (389 amino acids)

>PS417_08025 acetylornithine aminotransferase (Pseudomonas simiae WCS417)
MTAACLMTTYQPLALSFTRGLGTRLWDQQGREYLDAVAGVAVTNVGHSHPRLVAAISEQA
GLLLHTSNLYSIDWQQRLAQRLTQLSGLDRAFFNNSGAEANETALKLARLHGWKKGIEAP
LVVVMENAFHGRTLGTLAASDGPSVRLGFQQLPGDFLKVRFGDLAALEAITKAFGPRITA
VLLEPIQGESGVLPAPSGYLQALRDHCTRQGWLMMLDEIQTGIGRTGTWFAFQHEGIVPD
VMTLAKGLGNGVPIGACLARAAVAQLFTPGSHGSTFGGNPLACRVGCTVLDIIEEQGLLQ
NAAQQGERLLARLRVELNEHAQVVAIRGQGLMIGIELASPCRDLAQRAAQEHGLLINVTR
GKIIRLLPPLTLDTQEVEMIVRAITRLLA