Protein Info for GFF1577 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: YciL protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 99 PF03795: YCII" amino acids 1 to 87 (87 residues), 57 bits, see alignment E=1.2e-19

Best Hits

Swiss-Prot: 35% identical to Y828_HAEIN: Uncharacterized protein HI_0828 (HI_0828) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K09780, hypothetical protein (inferred from 67% identity to bpt:Bpet1522)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (99 amino acids)

>GFF1577 YciL protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MVYVFHLLDRPGAAALRDAVRPAHKAYLAQVEDRIAFAGPLLSDDGRSMVGSLLAIDFES
REAAVRWQQHEPFTQAGLYASAAVHAFENLWPKKSGQVP