Protein Info for GFF1576 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 transmembrane" amino acids 18 to 41 (24 residues), see Phobius details amino acids 53 to 78 (26 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 126 to 148 (23 residues), see Phobius details amino acids 161 to 186 (26 residues), see Phobius details amino acids 198 to 221 (24 residues), see Phobius details TIGR00427: membrane protein, MarC family" amino acids 15 to 214 (200 residues), 123.3 bits, see alignment E=5.5e-40 PF01914: MarC" amino acids 16 to 218 (203 residues), 132.6 bits, see alignment E=6.7e-43

Best Hits

KEGG orthology group: K05595, multiple antibiotic resistance protein (inferred from 50% identity to sno:Snov_3879)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>GFF1576 hypothetical protein (Xanthobacter sp. DMC5)
MSGVASEVILAALDFTLIAKVFAALFAIMNPLTIMPVFLSLTADKPAADQRSIMLTLNAT
VAAGCLICALGGRAVLSAFGIDVNHFQLAGGLIVLLLALSMLSGEDHSAHSGTAEEKKTY
NSASSLGVYPLGIPLALGPGSMTAIIVFSQMGASRPGGTVSFYLGLVGYVVFFSICMASA
PLLARFLSPNALSISKRLMGIVLAAIAMEMISTALGHIFPAWMA