Protein Info for GFF1574 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 628 transmembrane" amino acids 34 to 63 (30 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 347 to 376 (30 residues), see Phobius details amino acids 388 to 409 (22 residues), see Phobius details amino acids 415 to 433 (19 residues), see Phobius details amino acids 439 to 459 (21 residues), see Phobius details amino acids 471 to 489 (19 residues), see Phobius details PF13515: FUSC_2" amino acids 352 to 483 (132 residues), 38.9 bits, see alignment E=4.6e-14

Best Hits

Predicted SEED Role

"FIG01221613: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (628 amino acids)

>GFF1574 hypothetical protein (Xanthobacter sp. DMC5)
MAPAADAPWAQLARQTWLDLQAAAPGRFDMTWKVALLCALVAAVAMVFKVPEAAIGCYLV
IFLARPNGADNVQQAIGVIGLASVVVVTLAPVIQVTADLPLLRICVIAFVSFAFVFLGAA
SRLGEQGSIVALVIAFVLTLVDHLPIGEIATRGLLYAWQMAAMPMALMILFNLVFGTSPH
RLLRQRVVDRLEAAAAALEAPMSERRPRLDALLSEGLDPAAQEVVQARLFHTAPADAVRW
LSGAARTTYRLLLAVSALPDDVPAERCAAVARSCRTAAEAVKAGRRPNATATSPDVDRTD
LASQIAAMLVDLGAPNGGSDAAPPKAPFFLADAFSNPDYQRYALKTTAAAILCYLIYSLI
NWQGIHTAMITCYVAALGTTAETVHKLALRISGCLVGAAIGLFSILFVIPHLESVGGLMA
LVFVGLLPAAWVAAGSESISYAGVQVGLAFLLTVLNGFGPSLDMDAARDRVVGILLGNLV
VYVIFTTIWPKSALLEVRVHLSRILSTLAEIAARPPAGRADAVEEAARVETEAEQASQQL
LLLPFEPPSQRPAQATVAGLGALIALSRDMVPALMFGAAPDAILADRLSRAAADVSAEAG
ARASGDGAADPGGSLADRARRIEQAVAG