Protein Info for GFF1570 in Xanthobacter sp. DMC5

Annotation: Proline/betaine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 28 to 52 (25 residues), see Phobius details amino acids 64 to 87 (24 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details amino acids 123 to 152 (30 residues), see Phobius details amino acids 165 to 189 (25 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details amino acids 285 to 305 (21 residues), see Phobius details amino acids 314 to 333 (20 residues), see Phobius details amino acids 339 to 359 (21 residues), see Phobius details amino acids 379 to 400 (22 residues), see Phobius details amino acids 407 to 424 (18 residues), see Phobius details PF00083: Sugar_tr" amino acids 29 to 228 (200 residues), 88.5 bits, see alignment E=4.8e-29 amino acids 249 to 435 (187 residues), 34.8 bits, see alignment E=9e-13 PF07690: MFS_1" amino acids 59 to 333 (275 residues), 110.5 bits, see alignment E=8.8e-36 amino acids 278 to 423 (146 residues), 41.1 bits, see alignment E=1.1e-14

Best Hits

KEGG orthology group: K03762, MFS transporter, MHS family, proline/betaine transporter (inferred from 41% identity to rme:Rmet_3403)

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (437 amino acids)

>GFF1570 Proline/betaine transporter (Xanthobacter sp. DMC5)
LPSGGQFIEPVLEQAAAPARDPRRARAFFAAILCNTLEWYDFAVYGILATHISAAFFPQE
DRSAALLAALAVFGVSFVVRPIGGLILGGIGDRRGRKPALLISAGMMAVGALMIALLPPY
ATIGILAPVLLLAARLVQGFSAGGEWGVANAFLLEWSPEGKRGFWTSFMSVTVAFGSGLA
SAMAAILSAVLDAEAMADWGWRVPFLFGGLLGVAALWARIGIEETPVYREADRAATLPDN
PKANIRSSLLVIGFVIHWTVCYYIFLIYLPLYTKTHAGISAAQSAWSNAISTLVIMCVAP
MVGALSDRFGRKPFLLASTIAVILLTLPLFWVITVMPSFALVVAVQMVFGLAIALYSGSA
PAVSVELYPARVRSRWSSMSYALAVAIFGGFAPFIAVWLTGALNSPLAPAAYVIAASIVS
LLVIRQMPETAHRSIAG