Protein Info for GFF157 in Variovorax sp. SCN45

Annotation: Methyltransferase type 12

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 PF05401: NodS" amino acids 16 to 146 (131 residues), 48.4 bits, see alignment E=2.6e-16 PF13489: Methyltransf_23" amino acids 34 to 157 (124 residues), 27.8 bits, see alignment E=4.7e-10 PF08241: Methyltransf_11" amino acids 49 to 144 (96 residues), 35.7 bits, see alignment E=2.8e-12 PF13649: Methyltransf_25" amino acids 50 to 141 (92 residues), 43.4 bits, see alignment E=1.2e-14 PF08242: Methyltransf_12" amino acids 51 to 143 (93 residues), 46.1 bits, see alignment E=1.7e-15

Best Hits

KEGG orthology group: None (inferred from 71% identity to vpe:Varpa_0685)

Predicted SEED Role

"Methyltransferase type 12"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (201 amino acids)

>GFF157 Methyltransferase type 12 (Variovorax sp. SCN45)
VSEGQRPYFDALYARSDDPYELRYRWYESRKRDVLLAALPQPHYGKAYEPGCGAGELTHA
LAPRCGRLLASDFSDRAVQIARGRTREWSHVHVERQSLPGDWPHDADPFDLIVLSEVGYF
LSRDDMQRVAECCEASLAADGTLVACDWRPGFQQRSLSTDEVHGILGALGLARLVRHEED
DFVLHVWARDGRSVARREGIR