Protein Info for GFF1567 in Sphingobium sp. HT1-2

Annotation: Efflux ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 transmembrane" amino acids 24 to 46 (23 residues), see Phobius details amino acids 58 to 85 (28 residues), see Phobius details amino acids 106 to 131 (26 residues), see Phobius details amino acids 140 to 164 (25 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details amino acids 201 to 218 (18 residues), see Phobius details amino acids 228 to 248 (21 residues), see Phobius details PF01061: ABC2_membrane" amino acids 9 to 219 (211 residues), 107.5 bits, see alignment E=7.4e-35 PF12698: ABC2_membrane_3" amino acids 58 to 243 (186 residues), 31.7 bits, see alignment E=9.2e-12

Best Hits

Swiss-Prot: 43% identical to YADH_SHIFL: Inner membrane transport permease YadH (yadH) from Shigella flexneri

KEGG orthology group: K01992, ABC-2 type transport system permease protein (inferred from 91% identity to sjp:SJA_C1-20660)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>GFF1567 Efflux ABC transporter, permease protein (Sphingobium sp. HT1-2)
MNGPNLRAVAAIYKFELHRFRRTWLTGLLVPVITTSLYFIVFGGAIGSRMTQIDGIPYAA
FIVPGLIMMSMFTESIFNASFGIYMPKFTGTIYELLSAPVSAMETVIAYVGAAATKALIV
GFIIFATAHLFVDLPVAHPFAMVGFMLLIAVSFCLFGFILGIWAQGFEQLQVIPLLIITP
MTFLGGAFYSIHMLAEPWRTITLFNPIVYLISGFRWTFFGKGDVGIEFSLLFVGGMLAVC
LGIIAWVFRTGYRLKK