Protein Info for PS417_07965 in Pseudomonas simiae WCS417

Annotation: multidrug DMT transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 38 to 56 (19 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 216 to 238 (23 residues), see Phobius details amino acids 247 to 266 (20 residues), see Phobius details amino acids 271 to 288 (18 residues), see Phobius details PF00892: EamA" amino acids 9 to 139 (131 residues), 45.3 bits, see alignment E=5.3e-16 amino acids 155 to 288 (134 residues), 41.1 bits, see alignment E=1.1e-14

Best Hits

KEGG orthology group: None (inferred from 61% identity to bur:Bcep18194_B0659)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UEW0 at UniProt or InterPro

Protein Sequence (299 amino acids)

>PS417_07965 multidrug DMT transporter permease (Pseudomonas simiae WCS417)
MTRPTLKRLLLQVAFVLSWSSGYIGAKLGTQGGGAFNLLFWRFLLVSLCLGLLLNVRLLK
VSWVQVRHYAVIGFLSQFLYLSCLYVAIQNGLSPGIAAIIAATQPLMTAALSSGSAAERS
GGWQWTGLMISFVGVSIVIAGQYGGGGEGVGLVMYLLPLAAALGLTLATLYERRTVQRQD
AGLVLPLFIQSLLTLIGFTGAVLYTDTLSIPHDPDVLISIVWLTLFSTFVAYLSLWMLLR
VMTATQVAALVYLEPPVTLVWAALMFGDVIQVSTYAGIAVVVGGLLLIRRKRPTVACAS