Protein Info for GFF1564 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Carbon starvation induced protein CsiD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 PF08943: CsiD" amino acids 21 to 314 (294 residues), 491.6 bits, see alignment E=7.4e-152 PF02668: TauD" amino acids 93 to 309 (217 residues), 38.5 bits, see alignment E=1.3e-13

Best Hits

Swiss-Prot: 100% identical to GLAH_SALTY: Glutarate 2-hydroxylase (glaH) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 99% identity to sty:STY2909)

MetaCyc: 87% identical to glutarate dioxygenase GlaH (Escherichia coli K-12 substr. MG1655)
RXN0-7316 [EC: 1.14.11.64]

Predicted SEED Role

"Carbon starvation induced protein CsiD"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.11.64

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>GFF1564 Carbon starvation induced protein CsiD (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNALTAVKANTDDLAQRHTGFTLAPSAQSPRLLALTFTADTTKQFLHQVAQWPVQALEYK
SFLRFKIGKILDDLCGNQLQPLLIKTLLNRAQGALLISAEGIDDVAQAEEMVKLATAVAH
LIGRSNYDAMSGQYYARFVVKNVDNSDSYLRQPHRVMELHNDGTYVEEVTDYVLMMKIDE
QNMEGGNSLLLHLDDWEHLESFFTHPLARRVMRWAAPPSKNVSHDVWHPVFDVDQQGRPV
MRYIDQFVQPKDFEEGVWLSELSDALETSQNILSVPVPVGKFLLINNLFWLHGRDRFTPH
PDLRRELMRQRGYFAYAASHYQTHQ