Protein Info for GFF1563 in Xanthobacter sp. DMC5

Annotation: Transcriptional regulatory protein OmpR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 PF00072: Response_reg" amino acids 2 to 109 (108 residues), 72.7 bits, see alignment E=2.8e-24 PF00486: Trans_reg_C" amino acids 155 to 230 (76 residues), 82.9 bits, see alignment E=1.3e-27

Best Hits

Swiss-Prot: 43% identical to CSEB_STRAW: Transcriptional regulatory protein CseB (cseB) from Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)

KEGG orthology group: None (inferred from 76% identity to sno:Snov_1176)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (236 amino acids)

>GFF1563 Transcriptional regulatory protein OmpR (Xanthobacter sp. DMC5)
MVDDDRRMCGFVTKFLAREGFCADFALDGSAMRDALAATRFDLIILDLTFPRGEDGLSLA
RAVRAGWDMPLLVLSAKCETVDKIVCLELGADDYVTKPFEPRELLARVRALLRRANGAIR
APAPSPSPPPPMGHHLVFGVFRLDLDRRELTRQDGTRVALTSHEFRLLAALAERPGRVLT
RDQMLDLVANRQWAPFDRSIDVLVGKLRRKLEDGGGGDIIKTVRGEGYVFTPPAPH