Protein Info for GFF1559 in Xanthobacter sp. DMC5

Annotation: HTH-type transcriptional repressor CytR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 PF00356: LacI" amino acids 18 to 65 (48 residues), 51.1 bits, see alignment 1.8e-17 PF00532: Peripla_BP_1" amino acids 76 to 319 (244 residues), 103.9 bits, see alignment E=2.2e-33 PF13407: Peripla_BP_4" amino acids 80 to 323 (244 residues), 58.1 bits, see alignment E=2.1e-19 PF13377: Peripla_BP_3" amino acids 183 to 342 (160 residues), 129.8 bits, see alignment E=2.3e-41

Best Hits

KEGG orthology group: None (inferred from 67% identity to vei:Veis_1875)

Predicted SEED Role

"Maltose operon transcriptional repressor MalR, LacI family" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (347 amino acids)

>GFF1559 HTH-type transcriptional repressor CytR (Xanthobacter sp. DMC5)
MVGKGDLAGGSGGMARVTLADVARAAGVDMSTASRVLRGEASQRVREETRVRILKIAEEM
QYLANPLARGLRTQRTDTLGIVVPQLDNPVFASAIRGAELEAAERGYSLLISHREPGETA
TTIAKISRTNRVDGLLVASLDDDEVLRTDLAAARVPFVLMNRILPGAPLSVVLDSRAAAR
KGVEHLTALGHRRIAHLAGREGGFNARERLQGYRDGLEAAGIAFDEALVGVAGYTAEGGT
QAMRALLPQHPTAVLAATLVSAAGAMATLHEAGLRIPEDISVIGLHDAPVAGMLYPALTS
VAMPTEEMGRVAAGLLIRALGGEDPAPVAPLPPGALVVRGSTGPAPL