Protein Info for GFF1558 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Tricarboxylate transport transcriptional regulator TctD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 PF00072: Response_reg" amino acids 4 to 112 (109 residues), 92.4 bits, see alignment E=2.1e-30 PF00486: Trans_reg_C" amino acids 144 to 217 (74 residues), 70.4 bits, see alignment E=1.1e-23

Best Hits

Swiss-Prot: 100% identical to TCTD_SALTS: Transcriptional regulatory protein tctD (tctD) from Salmonella typhimurium (strain SL1344)

KEGG orthology group: K07774, two-component system, OmpR family, response regulator TctD (inferred from 99% identity to stt:t2679)

Predicted SEED Role

"Tricarboxylate transport transcriptional regulator TctD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>GFF1558 Tricarboxylate transport transcriptional regulator TctD (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MRLLLAEDNRELAHWLEKALVQNGFAVDCVFDGLAADHLLHSEMYALAVLDINMPGMDGL
EVVQRLRKRGQTLPVLLLTARSAVADRVKGLNVGADDYLPKPFELEELDARLRALLRRSA
GQVHEVQQLGELIFHDEGYFLLQGQPLALTPREQALLTVLMYRRTRPVSRQQLFEQVFSL
NDEVSPESIELYIHRLRKKLQGSDVRITTLRGLGYVLERGDEVG