Protein Info for GFF1556 in Sphingobium sp. HT1-2

Annotation: D-beta-hydroxybutyrate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 55 to 73 (19 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details amino acids 140 to 157 (18 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 284 to 307 (24 residues), see Phobius details amino acids 320 to 346 (27 residues), see Phobius details amino acids 365 to 386 (22 residues), see Phobius details amino acids 443 to 464 (22 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 86% identity to sjp:SJA_C1-15980)

Predicted SEED Role

"D-beta-hydroxybutyrate permease" in subsystem Polyhydroxybutyrate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (467 amino acids)

>GFF1556 D-beta-hydroxybutyrate permease (Sphingobium sp. HT1-2)
MAVAIAALALILLMLAAYRGMSVILMAPLLAMLAVFLTDPAAVPTAFSGLFMDKVATFLK
LYFPVFLLGALFGKLVEISGFSRAIVTAVIGFVGAGRAIPAIMIVTALLTYGGVSVFVAV
FAVYPFAAEMFRRADIPKRLVPATIGLGALTFTMDALPGTPQIQNVIPASFFGTTAWAAP
VLGVIGSVVIAAAGLAYLNWRRRAMAAAGEGYGAPETLVNEPDRQEEAATVHPLVALLPL
LVVGLGNLALTLLIPRITGGAEEVSIRLAGLPEPVTAKVTQQAALWAVEGALLMGIATIL
IFAFPVVARRFAEGSKAAVGGALLAGMNTAVEYGFGGVIAALPGFLVVKDALKAVPNPLI
NEAITVTTLAGITGSASGGLSIALAAMADQFVAAGDAAGIPREVLHRVASMASGGMDSLP
HNGAVITLLAVTGLTHRQAYKDIFALTLIKTMTVFVVIAVYYLTGLV