Protein Info for GFF1554 in Xanthobacter sp. DMC5

Annotation: Inner membrane ABC transporter permease protein YcjO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 65 to 90 (26 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 150 to 175 (26 residues), see Phobius details amino acids 197 to 221 (25 residues), see Phobius details amino acids 227 to 231 (5 residues), see Phobius details amino acids 256 to 280 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 80 to 281 (202 residues), 88.2 bits, see alignment E=3e-29

Best Hits

Swiss-Prot: 34% identical to MALF_THELN: Trehalose/maltose transport system permease protein MalF (malF) from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 74% identity to vei:Veis_1880)

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalF" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>GFF1554 Inner membrane ABC transporter permease protein YcjO (Xanthobacter sp. DMC5)
VSSKATIYSFLFLGLAVTALLIVAPVVYAVSLSFYQMDSFVGAPKWAGLDNYTRMLSQWV
FWRALINGFIYSFGTIIFQVVLGIGFALVLNQVFPGRNIVRGLSILPYLLPTVVVVLTFK
WMVDGSIGVLTTMMSALGLPQVQWFESPGAAMASVILVSVWMWTPFVTTTFLAALQTVPS
SLYEAAKVDGTNAVQRFFHITLPMLKPILTVIVLLRAVWMFNKFDVIWLLTQGGPVGATE
HLAILSYKQAFGQFDIGGGAAVATISFAILSLVVFIYFRLFPLDTE