Protein Info for GFF1554 in Sphingobium sp. HT1-2

Annotation: Abortive infection protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 32 to 49 (18 residues), see Phobius details amino acids 70 to 87 (18 residues), see Phobius details amino acids 100 to 122 (23 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details PF02517: Rce1-like" amino acids 133 to 233 (101 residues), 48.9 bits, see alignment E=3.4e-17

Best Hits

KEGG orthology group: K07052, (no description) (inferred from 65% identity to cse:Cseg_3901)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (238 amino acids)

>GFF1554 Abortive infection protein (Sphingobium sp. HT1-2)
MNGVIGLLGTLALLLAAGGAIGLIDRSGFRPGWLLVAVALVAANDALLTRAYRHIPDLIP
AADWNWQGKLLALALTLLVAALPAFGWKRVGLTLRQARGSLTAALPVALLYCAFFTALAL
YFPDDPSSAEEIAFQLTMPGLEEEPFYRGILLFALDRAFTRRVRFLGVDWGWGALLSCGL
FGLAHAFGYSAGHFSFDPVVMALTAIPSLLAVWLRLRTGSLLLPILLHNFGNAISLML