Protein Info for GFF1553 in Xanthobacter sp. DMC5

Annotation: Inner membrane ABC transporter permease protein YcjP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 73 to 97 (25 residues), see Phobius details amino acids 108 to 133 (26 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details amino acids 185 to 208 (24 residues), see Phobius details amino acids 246 to 269 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 89 to 258 (170 residues), 48.5 bits, see alignment E=4.6e-17

Best Hits

Swiss-Prot: 37% identical to YCJP_ECOLI: Inner membrane ABC transporter permease protein YcjP (ycjP) from Escherichia coli (strain K12)

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 79% identity to vei:Veis_1881)

MetaCyc: 31% identical to ABC-type sulfoquinovose transporter permease subunit (Clostridium sp. MSTE9)
7.5.2.-

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalG" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (279 amino acids)

>GFF1553 Inner membrane ABC transporter permease protein YcjP (Xanthobacter sp. DMC5)
MTRSSPRSLAGRVALYAAATLIAVYSAFPIYWMVVSSTRAPQALINSTSLLPGPFTWEYY
TNLLELTDYPSQFLNSLIVAAVTVVVTMVFSIMIAYAVTRHRIRGKGIIVGAMLYAYMFP
PLLIAIPMFSIFAKLGLGDTLTSVIVSHLTLTLPLGVWFLWGFFKSMPFELEEAAMVDGC
TRLGAFLRVVLPLSLPGLITVAIFSFLLSWTDYTYALIMIGSDANKTVPVGLASMVGSFD
LRWGEIMAGSTLIALPLFGAFALLSQYFIQGLGAGAVKG