Protein Info for GFF1552 in Sphingobium sp. HT1-2

Annotation: ABC-type antimicrobial peptide transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 278 to 302 (25 residues), see Phobius details amino acids 326 to 353 (28 residues), see Phobius details amino acids 366 to 385 (20 residues), see Phobius details PF12704: MacB_PCD" amino acids 20 to 241 (222 residues), 188.5 bits, see alignment E=1.9e-59 PF02687: FtsX" amino acids 281 to 394 (114 residues), 64 bits, see alignment E=1.4e-21

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 91% identity to sjp:SJA_C1-16000)

Predicted SEED Role

"Macrolide export ATP-binding/permease protein MacB (EC 3.6.3.-)" in subsystem Multidrug Resistance Efflux Pumps (EC 3.6.3.-)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (401 amino acids)

>GFF1552 ABC-type antimicrobial peptide transport system, permease component (Sphingobium sp. HT1-2)
MLGTTVILAFRAINRHKMRSFLTTLGIIIGVAAVVTMVTLGNGATAAVREQISSLGANVL
QLRPGQGFGRGGGGPRPPNFKEADLTAIENQLTGVRAVAPVVQSSGTAIYEGNNWSTTVY
GTTSAYSQVQSWNVSEGRLFMPDEEEAGKSVCIIGNTVRTNLFQGNDPIGKRMRIKGVSC
QVVGVLATRGQGGFGDQDDVVVMPIKFVQRRFTGDRDISQIMVAVDDAYDSATVQDSLEQ
LMRERRKIKAGAEDNFNVFDTKQISDTLTGTTTILTQIVAAVAAISLLVGGIGIMNIMLV
SVTERTREIGIRLAIGAVAREVLMQFLVEAIVLSCMGGLIGLVIALIASVGIAPLMKVPF
TFDPQVNLIAFLFSAAIGVVFGYFPARRAASLNPIDALRHE