Protein Info for GFF1551 in Sphingobium sp. HT1-2

Annotation: ABC-type antimicrobial peptide transport system, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 PF00005: ABC_tran" amino acids 26 to 174 (149 residues), 107.4 bits, see alignment E=9.4e-35

Best Hits

Swiss-Prot: 48% identical to Y1508_METJA: Uncharacterized ABC transporter ATP-binding protein MJ1508 (MJ1508) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K02003, (no description) (inferred from 92% identity to sjp:SJA_C1-16010)

MetaCyc: 42% identical to L-glutamine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Macrolide export ATP-binding/permease protein MacB (EC 3.6.3.-)" in subsystem Multidrug Resistance Efflux Pumps (EC 3.6.3.-)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (240 amino acids)

>GFF1551 ABC-type antimicrobial peptide transport system, ATPase component (Sphingobium sp. HT1-2)
MAADPIISLRGITKIFGSGPTAFQALKGIDLDIEQGDFVAVMGPSGSGKSTTMNILGCLD
VPSGGQFLFKGRHVETLDRDQRALLRRRYLGFVFQGFNLLARTSALENVELPLLYRGEDK
KTRYDMGMAALDKVGLKDWWDHTPAELSGGQQQRVAIARAIVTQPDVLLADEPTGNLDSE
RSVEIMQLLTDLNQNSGITVLMVTHEPDMAEFARTIVHFKDGLVERIEKGLGGPQKGAVG