Protein Info for GFF1548 in Variovorax sp. SCN45

Annotation: Tripartite tricarboxylate transporter TctA family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 25 to 49 (25 residues), see Phobius details amino acids 108 to 132 (25 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 203 to 223 (21 residues), see Phobius details amino acids 259 to 282 (24 residues), see Phobius details amino acids 322 to 342 (21 residues), see Phobius details amino acids 354 to 375 (22 residues), see Phobius details amino acids 379 to 405 (27 residues), see Phobius details amino acids 414 to 432 (19 residues), see Phobius details amino acids 470 to 489 (20 residues), see Phobius details PF01970: TctA" amino acids 20 to 439 (420 residues), 524.8 bits, see alignment E=7.2e-162

Best Hits

KEGG orthology group: None (inferred from 83% identity to aav:Aave_4452)

Predicted SEED Role

"Tricarboxylate transport membrane protein TctA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (508 amino acids)

>GFF1548 Tripartite tricarboxylate transporter TctA family (Variovorax sp. SCN45)
MDLLSNLWLGLQVAAEPITLAYCFFGVLLGTIVGVLPGIGALAAISLLLPLTYHMPPTAA
IIMLAGVYYGSQYGGSTASILLNLPGTPSSAVTCLDGYPMTKKGKAGVALFVTTIASLVG
AMSGLILLVLFSPAIAGIGLKFGPAEFFSMMVLGLVAASSMTSGSPAKGLCMVVFGLLLG
MVGTDVNSGVARFSFDVPELMDGINLIALAMGLFGVAEVVRCINSAETSQRPEKVTLKSM
VPTSDEFKATIKPMVRGSALGSALGALPGVGPSIAAFMSYAIEKKVAKDPSRFGHGAIEG
ITAPESANNASAQTAFVPSLSLGIPGDAVMAVMMGALIIHGIQPGPMLITEQPAMFWGLV
VSFAIGNIMLVVLNLPTIGLWVALLRIPFAWMYPAILVFVALGVYSVNNNAFDIYTVAIL
GIMGYALMVLRFEPAPLLLGYILGPMLEEHLRRAMLLSRGDPTVFIERPISAALLACTAA
MLAWAAWSTVRKTVRSKRTLDAARSAAA