Protein Info for GFF1547 in Xanthobacter sp. DMC5

Annotation: Aliphatic amidase expression-regulating protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 transmembrane" amino acids 185 to 195 (11 residues), see Phobius details PF13433: Peripla_BP_5" amino acids 1 to 356 (356 residues), 390.5 bits, see alignment E=8.3e-121 PF13458: Peripla_BP_6" amino acids 4 to 320 (317 residues), 164.3 bits, see alignment E=6.2e-52

Best Hits

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 64% identity to rpx:Rpdx1_3104)

Predicted SEED Role

"Urea ABC transporter, urea binding protein" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (373 amino acids)

>GFF1547 Aliphatic amidase expression-regulating protein (Xanthobacter sp. DMC5)
MFSTTGPYSTVASAMLNGALLAVSEIGEAGPVELVPVVVDPGGDLSRYTALSGQLLAEGV
RHVVGCYTSSSRKEVIPCFEKHDGMLWYPSHYEGFESADNVVYTGAAPNQHILPLIDYLM
STFGDRAFCVGSNYIWAWENSRILRETVTARGGTVVAERYLPVGETDLRKLVDAVIEARP
SFVFSSLIGVSGLAFLNALRHACLARGIDQPGTMPVASCNLSEPDLDELEPEARDGHISS
SVYFSALRNPVNDAFVSRHAAAYPSAPLTSADAEASYIAVKLLAGALAEAGTDEILAVKA
AVARQRLAAPQGDVWVDAETMHLHLTPRIGRSRGTEFDIIREEPAPIRPDPYLVRSSPTD
SWFASAPRLRVAK