Protein Info for GFF1546 in Xanthobacter sp. DMC5

Annotation: Cobalt-containing nitrile hydratase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 transmembrane" amino acids 29 to 46 (18 residues), see Phobius details amino acids 66 to 84 (19 residues), see Phobius details PF21006: NHase_beta_N" amino acids 1 to 107 (107 residues), 112.4 bits, see alignment E=1.3e-36 TIGR03888: nitrile hydratase, beta subunit" amino acids 1 to 224 (224 residues), 213.1 bits, see alignment E=2.4e-67 PF02211: NHase_beta_C" amino acids 128 to 222 (95 residues), 96 bits, see alignment E=1.5e-31

Best Hits

KEGG orthology group: K01721, nitrile hydratase [EC: 4.2.1.84] (inferred from 43% identity to rlg:Rleg_6980)

Predicted SEED Role

"Cobalt-containing nitrile hydratase subunit beta (EC 4.2.1.84)" (EC 4.2.1.84)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.84

Use Curated BLAST to search for 4.2.1.84

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>GFF1546 Cobalt-containing nitrile hydratase subunit beta (Xanthobacter sp. DMC5)
MKVQHFLGGIENLGPVAVEKRVFVEPWEAQLFAVHTTMMGTGIWAWPDLRVLAEGMSPLD
YFKYRYYIKWLGGMCHFLVAKNYISEKELEERTKHFLEHPDAPLPNSGDNAVTERVIEYF
YTGANPYRDVAVDPLFKVGDKVRVKDMPPAVHTRLPGYLRNKVGVIDTVYKGAYLYADNV
PTDGISTTQPVYLVKFKTRDLWSDIPDKGDVLYNDCFEVYLEAA