Protein Info for GFF1546 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: FIG00960493: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 PF07063: HGLS" amino acids 10 to 387 (378 residues), 516.5 bits, see alignment E=2.9e-159

Best Hits

Swiss-Prot: 58% identical to YDCJ_ECOLI: Uncharacterized protein YdcJ (ydcJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 59% identity to del:DelCs14_0937)

Predicted SEED Role

"FIG00960493: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>GFF1546 FIG00960493: hypothetical protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MHPDDIRTLFSRAMSDLYRTEVPQYGSLCDLVAQVNEAELARNPRLAQRLRRDGQLDRLE
VERHGAIRLGSARELATIRRLFALMGMRPVGYYDLSAAGVPVHSTAFRPVTDASLDHNPF
RVFTSLLRLELIADAALRQRAQEILSRRQIFTARCLALLEQAEQQGGLAAGDAREFVSEL
IHTFKWHHEATVDLATYRQLRSAHALVADIVCFKGPHINHLTPRTLDIDQVQQRMPGADL
AAKDSIEGPPRRAVPVLLRQTSFLALEEPIRFIGEAGDGTHTARFGEVEQRGCALTRKGR
ALYDQLLAQARSGVKNAFDAFPDDVQALFQDGLAFFRFEVDAARLAQTAPPADAELPQLV
AGGWLALTPITYEDFLPVSAAGIFRSNLGEEVRSSYDSQGQQAAFEQALGSPVMDEIALY
EAAQAASLAACERRLRAACATGSVG