Protein Info for GFF1545 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 48 to 68 (21 residues), see Phobius details amino acids 132 to 161 (30 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 210 to 234 (25 residues), see Phobius details amino acids 241 to 263 (23 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details amino acids 337 to 365 (29 residues), see Phobius details amino acids 398 to 398 (1 residues), see Phobius details amino acids 400 to 423 (24 residues), see Phobius details PF09594: GT87" amino acids 124 to 346 (223 residues), 119.6 bits, see alignment E=9.8e-39

Best Hits

KEGG orthology group: None (inferred from 40% identity to rpc:RPC_4123)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (436 amino acids)

>GFF1545 hypothetical protein (Sphingobium sp. HT1-2)
VRFGNKKPEKTRKERVVYQNFSRLCQSTAMIDRLCPDQFITPERVRMTAWLMLAATLIGL
AYLFATAHGTVDSLGRPLGTDFSNVWTAGWMADQGQATQAWNWPAHYEVQKAIHHDPAIP
FYGWHYPPPFLILATLLAQIPYVPALILWQGLTLGGALMVIRYVLPDQRDALLIALGAPV
VMVCLGHGQNAFMTAGLLGGGMGLLDRRPWIAGMLLGALVYKPQFAVLIPVLIIARGNAR
AFLAAGLTSAGLCLLTLLIWGWPVWQAFIDSLPLTQHIIIENGATGWEKIQSPFAAIRQW
GGSIPAAYVVQGLVTAIAIGIAALVARRGTMEVRGAAALSAALLCTPYVLDYDYVLLGMA
IAFVAADMGKRGMLGWERSWLAYAWMAPLFGRAVSEWTHVPVNLIAAIAVLALAMRRAIL
LDGALAYSLPGRTKIA