Protein Info for GFF1543 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: DNA-invertase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 transmembrane" amino acids 163 to 180 (18 residues), see Phobius details PF00239: Resolvase" amino acids 4 to 136 (133 residues), 162.5 bits, see alignment E=7.1e-52 PF02796: HTH_7" amino acids 139 to 182 (44 residues), 66.8 bits, see alignment 1.5e-22

Best Hits

Swiss-Prot: 100% identical to HIN_SALTY: DNA-invertase hin (hin) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 100% identity to see:SNSL254_A2967)

MetaCyc: 66% identical to e14 prophage; site-specific DNA recombinase (Escherichia coli K-12 substr. MG1655)
5.99.1.-

Predicted SEED Role

"DNA-invertase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (190 amino acids)

>GFF1543 DNA-invertase (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MATIGYIRVSTIDQNIDLQRNALTSANCDRIFEDRISGKIANRPGLKRALKYVNKGDTLV
VWKLDRLGRSVKNLVALISELHERGAHFHSLTDSIDTSSAMGRFFFHVMSALAEMERELI
VERTLAGLAAARAQGRLGGRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYF
PASRIKKRMN