Protein Info for GFF1542 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 40 to 64 (25 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 122 to 139 (18 residues), see Phobius details amino acids 151 to 174 (24 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details PF04955: HupE_UreJ" amino acids 16 to 197 (182 residues), 110.9 bits, see alignment E=2.7e-36

Best Hits

KEGG orthology group: K03192, urease accessory protein (inferred from 58% identity to sno:Snov_2575)

Predicted SEED Role

"HupE-UreJ family cobalt transporter" in subsystem Coenzyme B12 biosynthesis or Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (207 amino acids)

>GFF1542 hypothetical protein (Xanthobacter sp. DMC5)
MSRLVSRIALLSLVPLFAATSAEAHHAMGGRLPATFGEGFISGLAHPVIGLDHLGFIVAA
GLIAGVMGLGAFVPVAFVVASIAGVMLHVQLVNLPFAETVIALSVVAIGGLLAAGREKPA
RGVWIGLFAIAGLFHGYAYGESIVGAEPTQLVAYLAGLAVVQSVIGAGVALVASGRAWTP
TSLAPRLAGAAAFGIGLSAVVTQLIPG