Protein Info for GFF1537 in Sphingobium sp. HT1-2

Annotation: Ferredoxin reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 PF07992: Pyr_redox_2" amino acids 4 to 303 (300 residues), 224 bits, see alignment E=1.3e-69 PF00070: Pyr_redox" amino acids 146 to 226 (81 residues), 58.5 bits, see alignment E=3.7e-19 PF14759: Reductase_C" amino acids 322 to 405 (84 residues), 101.6 bits, see alignment E=1.2e-32

Best Hits

Swiss-Prot: 70% identical to CNDC1_SPHSD: Chloroacetanilide N-alkylformylase, ferredoxin reductase component (cndC1) from Sphingomonas wittichii (strain DC-6 / KACC 16600)

KEGG orthology group: None (inferred from 89% identity to sch:Sphch_0328)

MetaCyc: 58% identical to carbazole 1,9a-dioxygenase ferredoxin reductase component (Sphingomonas sp. XLDN2-5)
RXN-11511 [EC: 1.14.12.22]

Predicted SEED Role

"Ferredoxin reductase" in subsystem Anaerobic respiratory reductases

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.12.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (408 amino acids)

>GFF1537 Ferredoxin reductase (Sphingobium sp. HT1-2)
MSYYDVLIVGAGHAGAQAAISLRQHGFEGSVGMIGDEKDPPYERPPLSKEYFAGDKSFDR
ILIRPAAFWDERKIDMLLGKRVKSVDPVGKFVTVGEAEIGYDKLIWCAGGSPRMLTCSGA
EAANVHAVRRRDDVDAMMAKIDSVNHVTIIGGGYIGLEAAAVLSKFGKTVVLLEALDRVL
ARVAGEDLSRFYEAEHRAHGVDLRTGAKMDCIAVEDGRATAVLMQDGERIETDMVIVGIG
IVPETGPLIAAGAAGGNGVDVDEYCRTSLPDIYAVGDCAAHANRFAGGAQMRLESVQNAN
DQAKTAVAHILGKEEAYDAVPWFWSNQYDLKLQTVGLSTGFDQTVLRGDPATRSFSVVYL
KGGKVIALDCVNAVKDYVQGRAHVLSGAHLDPAQLADAGIPLKEVGLA