Protein Info for GFF1532 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Transcriptional repressor of aga operon

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 PF08220: HTH_DeoR" amino acids 11 to 64 (54 residues), 57.1 bits, see alignment E=1.8e-19 PF08279: HTH_11" amino acids 11 to 53 (43 residues), 31.9 bits, see alignment 1.5e-11 PF00455: DeoRC" amino acids 89 to 239 (151 residues), 54.3 bits, see alignment E=2.4e-18

Best Hits

KEGG orthology group: None (inferred from 99% identity to sek:SSPA2913)

Predicted SEED Role

"Transcriptional repressor of aga operon" in subsystem N-Acetyl-Galactosamine and Galactosamine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (277 amino acids)

>GFF1532 Transcriptional repressor of aga operon (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VAKPSTSLLKRRLDIAEIVRKNGEIKVDDLAEMLSVSGVTIRNDLNYLEQQGYLKRSFGG
AIYTAQPVRAAVSHEVVQSQALEHSVELELAKQVARLVCDDDTVFLGAGEVLRKALPFLG
DYRDLCLIINDLSHVAPARDYIDGEIVLLGGVLGHSGQALGGEIAIQSLQQFQPSCCLVM
VDHISEDGTLNVKNESAAALLSECLRLSGQSIAVVAQRPIHDVARYPVGKLNTLSAIITP
QIVAAEYHSRFLADGLTNSYTNNECLTWINPTLHQAR