Protein Info for GFF1525 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 38 to 58 (21 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 94 to 112 (19 residues), see Phobius details amino acids 132 to 149 (18 residues), see Phobius details amino acids 179 to 201 (23 residues), see Phobius details amino acids 217 to 242 (26 residues), see Phobius details amino acids 254 to 275 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 14 to 264 (251 residues), 112.2 bits, see alignment E=1.3e-36

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 43% identity to bav:BAV2834)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>GFF1525 hypothetical protein (Xanthobacter sp. DMC5)
MMAALDGFLASYGNLVNLCLLNTLLAYGVWLALAANMFTLGTGGFMAVGAYCSVYLTMQL
GAPFAVAVVAGGLLAAAVALVIGAPVLRLRGDYFMLATFAFTEVVRVIALNWDAVTGGAI
GIYGIPRYTETWQLVLLVLIALYFVFALRRSYFGRSIAAIRQDDVMSEAMGVNVFGQRLS
LFVASGFVSGGVGGLAAHLNFFVGPSDFGLLRSVDALAYPILGGVNALLGPLVGAIFTTL
LPELLRFSSQWREILMGLLILAVVLFLPGGAMSLLRWRPRKAAARRPSTQGAE