Protein Info for GFF1525 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: PTS system, galactitol-specific IIB component (EC 2.7.1.69)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 94 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF02302: PTS_IIB" amino acids 4 to 86 (83 residues), 49 bits, see alignment E=4e-17

Best Hits

Swiss-Prot: 81% identical to PTKB_ECO57: PTS system galactitol-specific EIIB component (gatB) from Escherichia coli O157:H7

KEGG orthology group: K02774, PTS system, galactitol-specific IIB component [EC: 2.7.1.69] (inferred from 99% identity to sew:SeSA_A3448)

MetaCyc: 78% identical to galactitol-specific PTS enzyme IIB component (Escherichia coli EC3132)
TRANS-RXN-161 [EC: 2.7.1.200]; TRANS-RXN-169 [EC: 2.7.1.200, 2.7.1.198]

Predicted SEED Role

"PTS system, galactitol-specific IIB component (EC 2.7.1.69)" in subsystem D-Tagatose and Galactitol Utilization (EC 2.7.1.69)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.198 or 2.7.1.200 or 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (94 amino acids)

>GFF1525 PTS system, galactitol-specific IIB component (EC 2.7.1.69) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKRKVIVACGGAVATSTMAAEEIKELCDANHIELDLVQCRVTEIETYMDGADLICTTARV
DRAFGNIPVVHGMPFVSGVGIEALQQKILSILMG