Protein Info for GFF1521 in Xanthobacter sp. DMC5

Annotation: putative nicotinate-nucleotide pyrophosphorylase [carboxylating]

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 TIGR00078: nicotinate-nucleotide diphosphorylase (carboxylating)" amino acids 12 to 276 (265 residues), 299.2 bits, see alignment E=1.2e-93 PF02749: QRPTase_N" amino acids 30 to 109 (80 residues), 59.5 bits, see alignment E=3e-20 PF01729: QRPTase_C" amino acids 111 to 276 (166 residues), 195.5 bits, see alignment E=5.8e-62

Best Hits

Swiss-Prot: 43% identical to NADC_PSEAE: Nicotinate-nucleotide pyrophosphorylase [carboxylating] (nadC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00767, nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC: 2.4.2.19] (inferred from 50% identity to dca:Desca_0158)

Predicted SEED Role

"Quinolinate phosphoribosyltransferase [decarboxylating] (EC 2.4.2.19)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.4.2.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.19

Use Curated BLAST to search for 2.4.2.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>GFF1521 putative nicotinate-nucleotide pyrophosphorylase [carboxylating] (Xanthobacter sp. DMC5)
MKLNRFMIRPLVELGLREELSSGDTTGGFLVGDDPVQTANIYAKANGIVCGMLFADETIR
SIEPDARIEWLVEDGAAVEPGTVLMRVEARASTFFVIERSALDWLQQMSGIATKTRRYAE
LVKHTGVRITDTRKGWPGLRMVQKYAVRVGGAHNHIFNLANCVLVKDNHIKIAGSITEAV
KILRASAQHTFKFEVECESLEMVQEALDAGVEIIMFDNMDLDEMREGLKLTKGRAMTEAS
GGINETTIVPIAELGVDVISIGDLTHTVKALDISLDVRDIKPSAQRTIDRLKQLSN