Protein Info for GFF1516 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Nucleoside-diphosphate-sugar epimerases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF01118: Semialdhyde_dh" amino acids 3 to 95 (93 residues), 29.5 bits, see alignment E=2.2e-10 PF01370: Epimerase" amino acids 4 to 111 (108 residues), 27.9 bits, see alignment E=4e-10 PF13460: NAD_binding_10" amino acids 8 to 188 (181 residues), 36.6 bits, see alignment E=1.1e-12 PF08732: HIM1" amino acids 53 to 159 (107 residues), 29.3 bits, see alignment E=1.5e-10

Best Hits

Swiss-Prot: 88% identical to YRAR_ECOLI: Putative NAD(P)-binding protein YraR (yraR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to sty:STY3451)

Predicted SEED Role

"Nucleoside-diphosphate-sugar epimerases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (211 amino acids)

>GFF1516 Nucleoside-diphosphate-sugar epimerases (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSQVLITGATGLVGGHLLRMLINTPQVSAIAAPTRRPLTDIVGVYNPHDPQLTDALAQVT
DPVDIVFCCLGTTRREAGSKAAFIHADYTLVVDTALTGRRLGAQHMVVVSAMGANAHSPF
FYNRVKGEMEEALIAQNWPRLTIARPSMLLGDRTTRRVNETLFAPLFRLLPGNWKSIDAR
DVARAMLAEALAPAQEGVTILTSSQLREKAE