Protein Info for GFF1515 in Variovorax sp. SCN45

Annotation: Flagellar hook-length control protein FliK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR04534: ELWxxDGT repeat" amino acids 55 to 99 (45 residues), 51.6 bits, see alignment 3.8e-18 amino acids 103 to 149 (47 residues), 72.7 bits, see alignment 9.6e-25 amino acids 152 to 194 (43 residues), 31.4 bits, see alignment 7.6e-12 amino acids 199 to 244 (46 residues), 60 bits, see alignment 9.2e-21 amino acids 247 to 291 (45 residues), 81.3 bits, see alignment 2e-27 amino acids 295 to 338 (44 residues), 75.9 bits, see alignment 1e-25 amino acids 342 to 387 (46 residues), 77.3 bits, see alignment 3.7e-26 amino acids 391 to 436 (46 residues), 44.9 bits, see alignment 4.8e-16

Best Hits

KEGG orthology group: None (inferred from 81% identity to vpe:Varpa_0714)

Predicted SEED Role

"Flagellar hook-length control protein FliK" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (475 amino acids)

>GFF1515 Flagellar hook-length control protein FliK (Variovorax sp. SCN45)
MTRAPMRFVRPVWLAALALLAQSCASARDPEREVLPEQRQRLAFVSPTGLTPLGGRVLFS
AFHVASGQELWITDGSIAGTAMLKDIRPGFRGSFPVWQTPFRGHVYFTATDGASGLELWR
TDGTAAGTSLVIDLRPGEEGAMPSELTVFRDALYFVANDGSTGFQVWKTSGSTQTTTRVS
SIDAGPRAVARQLTVAGKRLFFTATTREHGHELWVSEGAPENTRMVKDIRPGIEDAEIQG
LTAVGDSIYFTANDGVHGAELWKSDGTERGTRMVKDIRPGDASSRPTHLIALDRMLYFAA
NDGIHGTELWKSDGTTAGTTLVKDIRPGAEGAIASPLSAMGGRLYFAATDGVSGAELWRS
DGTAKGTTLVKDIVPGAESGSPARFAAIGARLWFSANGGSATGVEPWTSDGSPAGTRAVA
DIAAGSRNSMPLGFRAFGDAVLFVADDGHGNERLWIRRGNGRVALIGDPLEQRLR