Protein Info for GFF1515 in Sphingobium sp. HT1-2

Annotation: Thioredoxin reductase (EC 1.8.1.9)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 8 to 298 (291 residues), 179.5 bits, see alignment E=3.7e-56 TIGR01292: thioredoxin-disulfide reductase" amino acids 8 to 309 (302 residues), 393.5 bits, see alignment E=2.2e-122 PF13738: Pyr_redox_3" amino acids 82 to 281 (200 residues), 59.2 bits, see alignment E=1.5e-19 PF00070: Pyr_redox" amino acids 149 to 213 (65 residues), 56.1 bits, see alignment E=1.5e-18

Best Hits

Swiss-Prot: 61% identical to TRXB_RICFE: Thioredoxin reductase (trxB) from Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)

KEGG orthology group: K00384, thioredoxin reductase (NADPH) [EC: 1.8.1.9] (inferred from 90% identity to sch:Sphch_1264)

Predicted SEED Role

"Thioredoxin reductase (EC 1.8.1.9)" in subsystem Glycine reductase, sarcosine reductase and betaine reductase or Thioredoxin-disulfide reductase or Wyeosine-MimG Biosynthesis (EC 1.8.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.9

Use Curated BLAST to search for 1.8.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>GFF1515 Thioredoxin reductase (EC 1.8.1.9) (Sphingobium sp. HT1-2)
MTATHSTRMLILGSGPAGLSAAIYGARAGLAPIVVQGMQPGGQLTITTDVENYPGFKDVI
QGPWLMEQMQAQAEHVGAQMMYDQIVDVDLSERPFKLKGDSGTLYVADTLVICTGAQAKW
LGVEGEEHLQGKGVSACATCDGFFYRGKKVVVIGGGNTAVEEALYLTNHSHDVTLIHRRD
SLRAEKILQQRLHAHPNIKVLWNKAVDKFVGGGTPEGLVGVDLIDTVTGEKSHVPTDGGF
VAIGHHPATELFDGKLPLDEGYIVVEKGTTHTAIPGVFAAGDVTDKIYRQAVTAAGMGCM
AALDVERFLAEADFEQLVEA